PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pahal.G01226.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family M-type_MADS
Protein Properties Length: 229aa    MW: 24277.6 Da    PI: 8.7699
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pahal.G01226.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF69.23.8e-221865249
                    ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEE CS
          SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyey 49
                    rie++  rqv fskRr+g++KKA+ELS+LC a+va i+fs+ gk + +
  Pahal.G01226.1 18 RIESDEARQVCFSKRRAGLFKKASELSILCSADVAAIVFSPAGKAFSF 65
                    8******************************************97766 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006626.324969IPR002100Transcription factor, MADS-box
SMARTSM004321.3E-32968IPR002100Transcription factor, MADS-box
CDDcd002652.27E-411081No hitNo description
SuperFamilySSF554551.31E-281082IPR002100Transcription factor, MADS-box
PRINTSPR004041.6E-201131IPR002100Transcription factor, MADS-box
PfamPF003191.1E-251865IPR002100Transcription factor, MADS-box
PRINTSPR004041.6E-203146IPR002100Transcription factor, MADS-box
PRINTSPR004041.6E-204667IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 229 aa     Download sequence    Send to blast
MAPPRRPSLG RQKIEIRRIE SDEARQVCFS KRRAGLFKKA SELSILCSAD VAAIVFSPAG  60
KAFSFGHPSV ESILDRFLDS SPVAGPGLSS AGDRAVSELN RQYGELRAQL DAEKARQERA  120
DETIRKERAA SSQAMVWVDA DLSAMGHDDL IAFWGALIGV QAAVAASADQ LLRDALLVGR  180
RGRQPAQLTG GAAFDVVAFG VRMQPPPGFA GVDLQGFGGQ ATILAPSF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3kov_A3e-1610102190Myocyte-specific enhancer factor 2A
3kov_B3e-1610102190Myocyte-specific enhancer factor 2A
3kov_I3e-1610102190Myocyte-specific enhancer factor 2A
3kov_J3e-1610102190Myocyte-specific enhancer factor 2A
3p57_A3e-1610102190Myocyte-specific enhancer factor 2A
3p57_B3e-1610102190Myocyte-specific enhancer factor 2A
3p57_C3e-1610102190Myocyte-specific enhancer factor 2A
3p57_D3e-1610102190Myocyte-specific enhancer factor 2A
3p57_I3e-1610102190Myocyte-specific enhancer factor 2A
3p57_J3e-1610102190Myocyte-specific enhancer factor 2A
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9626541e-127EU962654.1 Zea mays clone 244495 DNA binding protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004953445.11e-142PREDICTED: agamous-like MADS-box protein AGL29
TrEMBLK3Z0901e-142K3Z090_SETIT; Uncharacterized protein
STRINGSi019951m1e-142(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP122436128
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60440.14e-33AGAMOUS-like 62